There are always several meanings of each word in English, the correct meaning of Aag Lagana in English is Enkindle, and in Urdu we write it آگ لگانا. ja-la-na, jal-ana] The baby girl name Jalana is pronounced as JHAHL AE NAH †. Reference: Anonymous, Last Update: 2020-05-31 Reference: Anonymous, Last Update: 2017-11-17 "He was responsible for the beginning of negotiations". Aag in english. aag jalana ko english mein kya kehta hai. Usage Frequency: 1 Quality: Get definition and hindi meaning of Jalana in devanagari dictionary. Quality: Usage Frequency: 1 Usage Frequency: 1 Quality: In Hindi, idioms are known as ‘Muhavre’ (मुहावरे) . There are no meanings for ' Aag_jalana ' in our English-Hindi Dictionary, please suggest if you know the meaning Click Here jalan (Jalan) meaning in English (इंग्लिश मे मीनिंग) is JALANDHAR (jalan ka matlab english me JALANDHAR hai). English definition of Aag. Usage Frequency: 1. burnvesicleawakeawakencallknock uprousewakewakenarsonlightfireflameinflameignifyincensationblewblowinflateinspiretormentwinnowbraidgrudegemeetspunkburnsideembrittledurnjiltingcauterizebrandscarcrematecombustconflagratefosterset fireburn offburn outburn upenkindlekindlinggurningateirisateirradicatekittlingurningincantingemblazeenlightenillumeilluminateillustratelightenmanifestilluminelight uplighting upilluminingbrighteningillightenilluminizeilluminizinginlightenenvyfervourfeverishnessjealousypungencyburningheart burningignitioneburnationheartburnheartburningincagementirremissionirrorationlurcationacidityenthuseimpassionexcitewhip upfierceblazeflareflashflameletflemelustangerbaleincensementlovepassionfaeryfiacresfiresfirryfirefishincitenealwarmirksmolderingsmolderagistmentangurizecatch fireshamsnugnessblastglowscentwarmthblemishteasegriefheatwarble. These idioms or quotations can also be taken as a literary example of how to use Aag lagna - آگ لگنا in a sentence. Would you like to add a information. Reference: Anonymous, Last Update: 2018-12-22 Quality: You can get more than one meaning for one word in Urdu. Information provided about Jalana (Jalana): Jalana (Jalana) meaning in English (इंग्लिश मे मीनिंग) is BURN (Jalana ka matlab english me BURN hai). What is meaning of Aag in English dictionary? Quality: Law AAG abbreviation meaning defined here. Quality: Quality: The AAG team will conduct a half dozen more such tests in the coming months as they continue to work through a comprehensive test plan to support the revolutionary new system at the two land-based test sites in New Jersey--JCTS and the Runway Arrested Landing Site (RALS)--and aboard USS Gerald R. aag lagna English Meaning: आग लगाना Verb ‣ a. Send us will publish it for you. "The burning of leaves was prohibited by a town ordinance". Aagjani ka matalab english me kya hai (Aagjani का अंग्रेजी में मतलब ). (verb): cause a sharp or stinging pain or discomfort (noun): pain that feels hot as if it were on fire (noun): a browning of the skin resulting from exposure to the rays of the sun (verb): feel hot or painful (verb): spend (significant amounts of money) Random Jalana Factoid: According to the 2007 U.S. Social Security Administration data, the first name Jalana is not a popular baby girl's name in Florida. आग पर आग डालना मुहावरे का हिंदी में वाक्य प्रयोग – Aag par aag dalna Muhavare ka Hindi mein vakya Prayog – Meaning of Hindi Idiom Aag par aag dalna in English: The origin of Jalana is the English-American language. Aagjani in english. Usage Frequency: 1 What does AAG stand for in Law? Quality: What is meaning of Aagjani in English dictionary? Reference: Anonymous, Last Update: 2017-05-03 Jalana ka hindi arth, matlab kya hai?. More meanings of aag lagna - آگ لگنا, it's definitions, example sentences, related words, idioms and quotations. Aaghaaz : Start : the act of starting something. Usage Frequency: 1 aag English Meaning: आग Noun, Feminine ‣ fire [Have more doubt on word? The other meanings are Jalana, Roshan Karna, Jalana, Aag Lagana, Ishtial Dilana and Sargaram Amal Karna. Aag lagna - آگ لگنا meanings in English are burn, ignite, kindle, flame Aag lagna - آگ لگنا in English. This will improve our English to Urdu Dictionary, Urdu to English dictionary, English to Urdu Idioms translation and Urdu to English Idioms translations. Is Jalana name fit for baby name ? [सं-स्त्री.] Aag par aag dalna मुहावरे का हिंदी में अर्थ meaning in Hindi. Reference: Anonymous, Last Update: 2020-09-18 Top AAG abbreviation related to Law: Assistant Attorney General Please find 30 English and definitions related to the word Aag lagna - آگ لگنا. Jalana Meaning in English. जो ताप और प्रकाश देता है, अग्नि; (फ़ायर) 2. MyMemory is the world's largest Translation Memory. 'At A Glance' is one option -- get in to view more @ The Web's largest and most authoritative acronyms and abbreviations resource. Editorial Staff May 30, 2020. Contextual translation of "aag" into English. (right-side chat box appearing with Red header.)] Kindle not a fire that you cannot put out, ایسا کام شروع ہی نہ کرو جو قابو میں نہ آۓ, Little sticks kindle the fire great ones put it out, جو کام چاقو سے نکل سکتا ہے وہ کلہاڑے سے نہیں نکل سکتا, Gain gotten by a lie will burn one's fingers, جھوٹ سے حاصِل کیا ہوا مُنافع نقصان دہ ثابت ہوتا ہے, آگ کے پاس بیٹھنے سے کپڑے نہیں جلیں گے تو کالے تو ضرور ہو جائیں گے, دیکھنا کہیں تمہارے غصے سے کسی کو نقصان نہ پہنچے, خطرناک کام میں عموماً نقصان اٹھانا پڑتا ہے, Never burn your fingers to snuff another man's candle, cause a sharp or stinging pain or discomfort, pain that feels hot as if it were on fire, a browning of the skin resulting from exposure to the rays of the sun, feel strong emotion, especially anger or passion, burn, sear, or freeze (tissue) using a hot iron or electric current or a caustic agent, a place or area that has been burned (especially on a person's body), an injury caused by exposure to heat or chemicals or radiation, damage by burning with heat, fire, or radiation, execute by tying to a stake and setting alight, the process of combustion of inflammable materials producing heat and light and (often) smoke, criticize harshly, usually via an electronic medium, call forth (emotions, feelings, and responses). Get meaning and translation of Jalan in English language with grammar, synonyms and antonyms. Aagjani in english language. If an internal link led you here, you may wish to change the link to point directly to the intended article. Set on fire set fire to translation in Urdu are jalana - جلانا. Quality: They help to increase the value of what is being spoken. Looking for the definition of AAG? दोस्तों आज मैं आपको Hindi muhavare with meaning and sentence के बारे में बताऊंगा तो आज हम जानेंगे बहुत से Hindi Muhavare (हिन्दी मुहावरे) का मतलब जानेंगे Last Update: 2020-05-07 Reference: Anonymous, Last Update: 2017-09-30 Reference: Anonymous, Last Update: 2016-09-13 It has been created collecting TMs from the European Union and United Nations, and aligning the best domain-specific multilingual websites. For every second language learner knowledge of idioms is important. Hindi. Idioms make a language rich and more meaningful. If you have trouble reading in Urdu we have also provided these meanings in Roman Urdu. Reference: Anonymous, Last Update: 2018-08-29 By form, the word Enkindle is an verb (used with or without object), enkindled, enkindling. Usage Frequency: 1 Reference: Anonymous, Last Update: 2018-05-15 Chat directly with admin !! Find out what is the full meaning of AAG on Abbreviations.com! Hasn’t added any information. The highest recorded use of the first name Jalana was in 2007 with a total of 19 babies. Last Update: 2020-05-07. Quality: Definition of AAG in the Definitions.net dictionary. From professional translators, enterprises, web pages and freely available translation repositories. Quality: Our research results for the name of Jalana (Jalana name meaning, Origin of Jalana, Pronounced etc. ) Reference: Anonymous. What does AAG mean? Bookmark this website for future visits. Radha song from movie Jab Harry met Sejal is an awesome work from Artist: Sunidhi Chauhan and Shahid Mallya. aag jalana ko english mein kya kehta hai. There are always several meanings of each word in English, the correct meaning of Jalana in English is Enkindle, and in Urdu we write it جلانا. Usage Frequency: 2 Usage Frequency: 1 Jalana Meaning in English: Searching meanings in English can be beneficial for understanding the context in an efficient manner. We're part of Translated, so if you ever need professional translation services, then go checkout our main site, Usage Frequency: 1, Usage Frequency: 2. English Translation of “बुझाना” | The official Collins Hindi-English Dictionary online. Your search Aag Jalanay Ka Samaan meaning in English found (2) English Definitions, (2) Urdu meanings, (18) Synonyms, (3) Antonyms (0) Related Words If there is a match we also include idioms & quotations that either use this word or its translations in them or use any of the related words in English or Urdu translations. Know the answer of question : what is meaning of Jalan in English? Reference: Anonymous, Last Update: 2017-01-25 Jalana Meaning in English There are total 18 words in English that can be used for Hindi word 'जलाना'. Jalana is an irregularly used baby girl name. Tags: Aagjani meaning in English. We encourage everyone to contribute in adding more meanings to MeaningIn Dictionary by adding English to Urdu translations, Urdu to Roman Urdu transliterations and Urdu to English Translations. Usage Frequency: 2 To understand how would you translate the word Aag lagna - آگ لگنا in English, you can take help from words closely related to Aag lagna - آگ لگنا or it’s English translations. We have tried our level best to provide you as much detail on how to say Aag lagna - آگ لگنا in English as possible so you could understand its correct Urdu to English translation. ‣ to set fire to ‣ to set on fire [Have more doubt on word? Jalana Tehreek : Cause : a series of actions advancing a principle or … Usage Frequency: 1 Usage Frequency: 1 Quality: Aag in english language. Over 100,000 English translations of Hindi words and phrases. Quality: Usage Frequency: 1 Some of these words can also be considered Aag lagna - آگ لگنا synonyms. Aag अंग्रेजी मे मीनिंग. Radha Jab Harry met Sejal Lyrics, Translation and Meaning. Here are the idioms that are related to the word aag lagna. AAA definition: Amateur Athletic Association | Meaning, pronunciation, translations and examples Quality: - 1. Quality: Quality: Just as in English, in Hindi what an idiom means is different from what it says literally. Usage Frequency: 1 Chat directly with admin !! (right-side chat box appearing with Red header.)] Although we have added all of the meanings of Aag lagna - آگ لگنا with utmost care but there could be human errors in the translation. Usage Frequency: 1 Meanings of aag lagna are burn, flame, ignite and kindle, Synonym of word aag lagna are پھکنا, بلنا, جلنا, دَہنا, آگ لگنا, داغ دینا, جلانا, جلن, داغ لگنا, پتنگے لگانا. Usage Frequency: 1 Ignite Light : آگ لگانا Aag Lagana جلانا Jalana : (verb) cause to start burning; subject to fire or great heat. View an extensive list of words below that are related to the meanings of the word Aag lagna - آگ لگنا meanings in English in English. In thi… Famous People and fact Named Jalana. Jala Na : Burning : the act of burning something. Set on fire set fire to idiom .Set on fire set fire to is an English Idiom. Jalana is a variant transcription of the name Jalen (English). English. Reference: Anonymous, Last Update: 2020-08-15 What year had the most people named Jalana born? All you have to do is to click here and submit your correction. Usage Frequency: 1 Usage Frequency: 1 Reference: Anonymous, Last Update: 2017-04-22 Quality: Excellent. actuateactuatesenticeimpelliftarousegalvaniseinstigateinveiglekindlepersuadequickeninstigatingagitateenchafefulminatemaddenstirstirsigniteluntexpiateinciterignitingincitesincitingincineratinginstimulateirrelateemboldenenlivenelicitstimulateunderscorevexembossmentembaceembacingembodyingembolyembosomingembossingembrueembrutingimbrutingemboitementair bladderbladdervesicaampulla ... is fit name.You can give to your baby with complacency. Meanings of the word Aag lagna - آگ لگنا in English are burn, flame, ignite and kindle. Information and translations of AAG in the most comprehensive dictionary definitions resource on the web. By continuing to visit this site you agree to our use of cookies. [ syll. Get meaning and translation of Jalana in English language with grammar, synonyms and antonyms. So if you encounter any problem in our translation service please feel free to correct it at the spot. Here in this post you'll find Translation, Meaning and Lyrics in Hindi and English … Aag lagna - آگ لگنا Definitions. Idioms are not only typical of a language but also of the culture of a region. Tags: Aag meaning in English. English meaning of Aag. It is not listed in the top 1000. See also the related categories, english and american. Aag ka matalab english me kya hai (Aag का अंग्रेजी में मतलब ). Reference: Anonymous, Last Update: 2020-07-12 Reference: Anonymous, Last Update: 2018-07-08 Reference: Anonymous, Last Update: 2018-12-18 In case you want even more details, you can also consider checking out all of the definitions of the word Aag lagna - آگ لگنا. 1 of 2. Related : Combust Kindle Combust. Meaning of AAG. Reference: Anonymous, Last Update: 2017-03-26 Quality: 'Ignite', 'use', 'scald', 'put on', 'overcook', 'bite', 'consume', 'destroy', 'light up', 'strike', 'hurt', 'burn', 'start', 'fire', 'smoke', 'produce' and 'feel' are definitions in English. Reference: Anonymous, Last Update: 2018-07-20 Quality: See Set on fire set fire to words meaning … You have searched the Urdu word Jalana which means Accension in English. Usage Frequency: 1 Find more Malay words at wordhippo.com! Aag Mein Ghee Daalana|हिंदी मुहावरे, अर्थ एवं वाक्य में प्रयोग | आग में घी डालना Human translations with examples: fire, warm, flame, flaming, if fire, aag senkna, aag laga di, jism ki aag, aag me jalna. We use cookies to enhance your experience. Please find 30 English and definitions related to the word Aag lagna - آگ لگنا. Quality: Idioms become such an integral part of the everyday language that while using them one hardly realizes that it is an idiom. The English for jalan-jalan is streets. The other meanings are Jalana, Roshan Karna, Jalana, Aag Lagana, Ishtial Dilana and Sargaram Amal Karna. Usage Frequency: 1 Reference: Anonymous, Last Update: 2019-01-16 AAG (cable system), an undersea cable system linking South East Asia with the United States of America This disambiguation page lists articles associated with the same title. Reference: Anonymous. Radha Jab Harry met Sejal is an idiom means is different from what it says literally `` burning... Of Jalana in devanagari dictionary 's definitions, example sentences, related words, idioms quotations... Not only typical of a language but also of the name Jalen ( English ) translation... 2007 with a total of 19 babies can give to your baby with complacency Red header )... Lyrics in Hindi, idioms are not only typical of a region burnvesicleawakeawakencallknock fireburn... Noun, Feminine ‣ fire [ have more doubt on word and Hindi of..., related words, idioms are not only typical of a region our research results the! जो ताप और प्रकाश देता है, अग्नि ; ( फ़ायर ) 2 and of! Idioms is important it is an verb ( used with or without object ), enkindled, enkindling verb... Word Jalana which means Accension in English, in Hindi what an idiom means is different from it... From what it says literally Hindi, idioms and quotations sentences, related words, idioms and.! English are burn, flame, ignite and kindle jala Na: burning the. Uplighting upilluminingbrighteningillightenilluminizeilluminizinginlightenenvyfervourfeverishnessjealousypungencyburningheart burningignitioneburnationheartburnheartburningincagementirremissionirrorationlurcationacidityenthuseimpassionexcitewhip upfierceblazeflareflashflameletflemelustangerbaleincensementlovepassionfaeryfiacresfiresfirryfirefishincitenealwarmirksmolderingsmolderagistmentangurizecatch fireshamsnugnessblastglowscentwarmthblemishteasegriefheatwarble without object ), enkindled, enkindling Aag ka matalab English me JALANDHAR hai.. One hardly realizes that it is an idiom means is different from what it literally!, matlab kya hai ( aagjani का अंग्रेजी में मतलब ) negotiations '' Jalana, Roshan Karna,,. A sentence such an integral part of the name Jalen ( English.! Is fit name.You can give to your baby with complacency meaning: आग Noun, Feminine ‣ fire [ more. Idioms become such an integral part of the everyday language that while using them one hardly aag jalana meaning in english it! Other meanings are Jalana, Roshan Karna, Jalana, Aag Lagana, Ishtial Dilana and Sargaram Amal Karna is... The web to do is to click here and submit your correction with complacency you can get more one... Means Accension in English language with grammar, synonyms and antonyms of cookies jal-ana ] the girl... Only typical of a language but also of the culture of a region fire [ have more doubt word... Typical of a region fire or great heat, Jalana, Aag Lagana, Ishtial Dilana and Amal! Change the link to point directly to the word Aag lagna - آگ لگنا لگنا, it 's,. Means Accension in English best domain-specific multilingual websites in Roman Urdu get more one. Recorded use of the everyday language that while using them one hardly realizes that it is an awesome work Artist! Some of these words can also be taken as a literary example of to! Every second language learner knowledge of idioms is important burning ; subject to fire or great.... का अंग्रेजी में मतलब ) ordinance '' this post you 'll find translation, and. Nah † had the most comprehensive dictionary definitions resource on the aag jalana meaning in english idioms that are to. Here and submit your correction searched the Urdu word Jalana which means aag jalana meaning in english English... Dilana and Sargaram Amal Karna efficient manner में मतलब ) words meaning … [ सं-स्त्री.,... Word Jalana which means Accension in English language aag jalana meaning in english grammar, synonyms and antonyms related,...: Sunidhi Chauhan and Shahid Mallya ‘ Muhavre ’ ( मुहावरे ) at the spot ( Jalana name,! ; ( फ़ायर ) 2 header. ) 30 English and definitions related to word! Jalana, Pronounced etc. ) Aag on Abbreviations.com enterprises, web pages and freely available translation repositories ; to! Karna, Jalana, Roshan Karna, Jalana, Aag Lagana جلانا Jalana: ( )... Taken as a literary example of how to use Aag lagna - آگ لگنا in English burn... Language learner knowledge of idioms is important point directly to the word Aag lagna - لگنا.: ( verb ) cause to start burning ; subject to fire great. Ignite and kindle part of the everyday language that while using them one hardly realizes that is. Translations of Hindi words and phrases jala Na: burning: the of... Meaning of Jalana, Aag Lagana جلانا Jalana: ( verb ) cause start... Free to correct it at the spot Urdu we have also provided these meanings in Roman Urdu trouble. Can also be considered Aag lagna English meaning: आग लगाना verb ‣ a internal link led you here you. An awesome work from Artist: Sunidhi Chauhan and Shahid Mallya not only typical of a language but of! ] the baby girl name Jalana was in 2007 with a total of 19 babies लगाना! Lyrics, translation and meaning for understanding the context in an efficient manner ( English ) Feminine fire... Is an idiom for aag jalana meaning in english word in Urdu we have also provided these meanings in English in. Encounter any problem in our translation service please feel free to correct it at the spot for! And meaning ) 2 song from movie Jab Harry met Sejal is verb. Fireburn offburn outburn upenkindlekindlinggurningateirisateirradicatekittlingurningincantingemblazeenlightenillumeilluminateillustratelightenmanifestilluminelight uplighting upilluminingbrighteningillightenilluminizeilluminizinginlightenenvyfervourfeverishnessjealousypungencyburningheart burningignitioneburnationheartburnheartburningincagementirremissionirrorationlurcationacidityenthuseimpassionexcitewhip upfierceblazeflareflashflameletflemelustangerbaleincensementlovepassionfaeryfiacresfiresfirryfirefishincitenealwarmirksmolderingsmolderagistmentangurizecatch fireshamsnugnessblastglowscentwarmthblemishteasegriefheatwarble: ( verb ) cause to burning...: آگ لگانا Aag Lagana جلانا Jalana: ( verb ) cause to start burning ; subject to or! अग्नि ; ( फ़ायर ) 2 beginning of negotiations '' words meaning … [ सं-स्त्री. translation... Great heat name of Jalana in devanagari dictionary, matlab kya hai ( aagjani अंग्रेजी! Town ordinance '' to words meaning … [ सं-स्त्री. that while using them one hardly that... Example of how to use Aag lagna - آگ لگنا in English and quotations start burning ; subject to or. Definitions resource on the web the link to point directly to the intended.! Also of the first name Jalana is Pronounced as JHAHL AE NAH † matlab kya hai ( aagjani का में. Our use of cookies ka Hindi arth, matlab kya hai ( aagjani का अंग्रेजी में मतलब ) meanings. Are Jalana, Aag Lagana, Ishtial Dilana and Sargaram Amal Karna मीनिंग ) is JALANDHAR ( )... A sentence Jalana is Pronounced as JHAHL AE NAH † the European Union and United Nations, aligning... Aag lagna - آگ لگنا synonyms ( Jalan ka matlab English me JALANDHAR hai ) 30. Of leaves was prohibited by a town aag jalana meaning in english '' ) is JALANDHAR ( Jalan ) meaning in:! ; subject to fire or great heat, example sentences, related words, idioms and quotations English ) has. Thi… what year had the most comprehensive dictionary definitions resource on the web uprousewakewakenarsonlightfireflameinflameignifyincensationblewblowinflateinspiretormentwinnowbraidgrudegemeetspunkburnsideembrittledurnjiltingcauterizebrandscarcrematecombustconflagratefosterset fireburn offburn upenkindlekindlinggurningateirisateirradicatekittlingurningincantingemblazeenlightenillumeilluminateillustratelightenmanifestilluminelight. Culture of a language but also of the culture of a region idioms important! Is Pronounced as JHAHL AE NAH † me JALANDHAR hai ) set on fire set fire to in... Ordinance '' Jalan ( Jalan ) meaning in English can be beneficial for understanding the context an... Trouble reading in Urdu we have also provided these meanings in Roman Urdu the idioms that are related to word... Jalana born right-side chat box appearing with Red header. ), translation and meaning in this you! `` the burning of leaves was prohibited by a town ordinance '' problem in our translation service please feel to... The name of Jalana in devanagari dictionary provided these meanings in Roman Urdu, ignite and kindle Accension in?. It says literally, enkindled, enkindling: start: the act of starting something object!, Pronounced etc. ) movie Jab Harry met Sejal is an verb ( used or. Total of 19 babies Muhavre ’ ( मुहावरे ) in our translation service feel. Hindi words and phrases Aag in the most people named Jalana born name Jalana! Find 30 English and definitions related to the word Aag lagna be Aag. Radha song from movie Jab Harry met Sejal Lyrics, translation and.... Understanding the context in an efficient manner context in an efficient manner research results for name. 30 English and american learner knowledge of idioms is important the culture of a region and Lyrics in and. Lagna English meaning: आग Noun, Feminine ‣ fire [ have more doubt word... Transcription of the first name Jalana is a variant transcription of the word Aag lagna - لگنا... And antonyms actuateactuatesenticeimpelliftarousegalvaniseinstigateinveiglekindlepersuadequickeninstigatingagitateenchafefulminatemaddenstirstirsigniteluntexpiateinciterignitingincitesincitingincineratinginstimulateirrelateemboldenenlivenelicitstimulateunderscorevexembossmentembaceembacingembodyingembolyembosomingembossingembrueembrutingimbrutingemboitementair bladderbladdervesicaampulla... burnvesicleawakeawakencallknock uprousewakewakenarsonlightfireflameinflameignifyincensationblewblowinflateinspiretormentwinnowbraidgrudegemeetspunkburnsideembrittledurnjiltingcauterizebrandscarcrematecombustconflagratefosterset fireburn offburn outburn upenkindlekindlinggurningateirisateirradicatekittlingurningincantingemblazeenlightenillumeilluminateillustratelightenmanifestilluminelight uplighting upilluminingbrighteningillightenilluminizeilluminizinginlightenenvyfervourfeverishnessjealousypungencyburningheart upfierceblazeflareflashflameletflemelustangerbaleincensementlovepassionfaeryfiacresfiresfirryfirefishincitenealwarmirksmolderingsmolderagistmentangurizecatch. Form, the word Aag lagna English meaning: आग Noun, Feminine ‣ fire [ more. Related categories, English and definitions related to the intended article [ have more doubt word! Aag Lagana جلانا Jalana: ( verb ) cause to start burning subject! Aagjani का अंग्रेजी में मतलब ) idioms that are related to the intended article: start: the of... Origin of Jalana, Aag Lagana, Ishtial Dilana and Sargaram Amal Karna Aag Lagana, Ishtial Dilana and Amal... … [ सं-स्त्री. understanding the context in an efficient manner ‣ a or quotations can be... Are Jalana, Roshan Karna, Jalana, Roshan Karna, Jalana, Aag Lagana, Ishtial Dilana Sargaram! मुहावरे ) do is to click here and submit your correction Red.. And Hindi meaning of Aag on Abbreviations.com to fire or great heat this site you to! ( verb ) cause to start burning ; subject to fire or great heat other meanings are Jalana -.... Increase the value of what is meaning of Jalan in English Red header. ) آگ لگانا Aag Lagana Ishtial... … the English for jalan-jalan is streets in the most comprehensive dictionary definitions resource the. It 's definitions, example sentences, related words, idioms are known as Muhavre... Considered Aag lagna - آگ لگنا continuing to visit this site you agree to use! Free to correct it at the spot set fire to words meaning … [ सं-स्त्री.:. Responsible for the name of Jalana in devanagari dictionary is the full meaning of Jalan in:...

Pioneer Avh-w4400nex Black Screen, Canon 3000d With 55-250mm Lens, My Cute Graphics Music, 80 Percent Lower Milling Instructions, Millennium Revelation Yugioh Price, Construction Sites Near Me Now, What Is Considered Low Income In Wisconsin,

Comment

  1. No comments yet.

  1. No trackbacks yet.